Antibody data

Product number
PAB28476
Provider
Abnova Corporation
Product name
ZNF75A polyclonal antibody
Provider product page
Abnova Corporation - PAB28476
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF75A
Antigen sequence
QEEWELLDPTQKALYNDVMQENYETVISLALFVLP
KPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKL
KNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQK
TAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQEL
LKLM
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.