Antibody data

Product number
H00007627-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007627-B01, RRID:AB_1116339
Product name
ZNF75A MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00007627-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ZNF75A protein.
Antigen sequence
MYFSQEEWELLDPTQKALYNDVMQENYETVISLAL
FVLPKPKVISCLEQGEEPWVQVSPEFKDSAGKSPT
GLKLKNDTENHQPVSLSDLEIQASAGVISKKAKVK
VPQKTAGKENHFDMHRVGKWHQDFPVKKRKKLSTW
KQELLKLMDRHKKDCAREKPFKCQECGKTFRVSSD
LIKHQRIHTEEKPYKCQQCDKRFRWSSDLNKHLTT
HQGIKPYKCSWCGKSFSQNTNLHTHQRTHTGEKPF
TCHECGKKFSQNSHLIKHRRTHTGEQPYTCSICRR
NFSRRSSLLRHQKLHL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.