HPA001665

ZNF75A antibody from Sigma-Aldrich
FLJ31529
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001665
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001665, RRID:AB_1080751
Product name
Anti-ZNF75A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001665
Antibody type
Polyclonal
Antigen
Zinc finger protein 75A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEEWELLDPTQKALYNDVMQENYETVISLALFVLP
KPKVISCLEQGEEPWVQVSPEFKDSAGKSPTGLKL
KNDTENHQPVSLSDLEIQASAGVISKKAKVKVPQK
TAGKENHFDMHRVGKWHQDFPVKKRKKLSTWKQEL
LKLM
Storage
-20C
Provider Type Product Number
- No reagents -