HPA024742

MPP3 antibody from Sigma-Aldrich
DLG3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024742
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024742, RRID:AB_1854087
Product name
Anti-MPP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024742
Antibody type
Polyclonal
Antigen
MAGUK p55 subfamily member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SQDDPTWWQAKRVGDTNLRAGLIPSKGFQERRLSY
RRAAGTLPSPQSLRKPPYDQPCDKETCDCEGYLKG
HYVAGL
Storage
-20C
Provider Type Product Number
- No reagents -