HPA005532

ZNF701 antibody from MilliporeSigma / Merck KGaA
FLJ10891
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005532
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA005532, RRID:AB_1080746
Product name
Anti-ZNF701 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA005532
Antibody type
Polyclonal
Antigen
Zinc finger protein 701 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QIHASHHIGDTCFQEIEKDIHDFVFQWQENETNGH
EALMTKTKKLMSSTERHDQRHAGNKPIKNELGSSF
HSHLPEVHIFHPEGKIGNQVEKAINDAFSVSASQR
ISCRPKTRISNKYRNNFLQSSLLTQ
Storage
-20C
Provider Type Product Number
- No reagents -