HPA001556

ZNF597 antibody from Sigma-Aldrich
FLJ33071, HIT-4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001556
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001556, RRID:AB_1080740
Product name
Anti-ZNF597 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001556
Antibody type
Polyclonal
Antigen
Zinc finger protein 597 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AQGPILFEDLAVYFSQEECVTLHPAQRSLSKDGTK
ESLEDAALMGEEGKPEINQQLSLESMELDELALEK
YPIAAPLVPYPEKSSEDGVGNPEAKILSGTPTYKR
RVISLLVTIENHTPLVELSEYLGTNTLSEILDSPW
Storage
-20C
Provider Type Product Number
- No reagents -