Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405223 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 415 (ZNF415) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF415 antibody: synthetic peptide directed towards the N terminal of human ZNF415
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MAFTQLTFRDVAIEFSQDEWKCLNSTQRTLYRDVM
LENYR NLVSLDLSRN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel human gene ZNF415 with five isoforms inhibits AP-1- and p53-mediated transcriptional activity.
Cheng Y, Wang Y, Li Y, Deng Y, Hu J, Mo X, Li N, Li Y, Luo N, Yuan W, Xiao J, Zhu C, Wu X, Liu M
Biochemical and biophysical research communications 2006 Dec 8;351(1):33-9
Biochemical and biophysical research communications 2006 Dec 8;351(1):33-9
No comments: Submit comment
No validations: Submit validation data