HPA005553

ZNF415 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA005553
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA005553, RRID:AB_1859252
Product name
Anti-ZNF415 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA005553
Antibody type
Polyclonal
Antigen
Zinc finger protein 415 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DRRGIGNKSIKHQLGLSFLPHPHELQQFQAEGKIY
ECNHVEKSVNHGSSVSPPQIISSTIKTHVSNKYGT
DFICSSLLTQEQKSCIREKPYRYIECDKALNHGSH
MTVRQVSHSGE
Storage
-20C
Provider Type Product Number
- No reagents -