Antibody data

Product number
H00001671-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001671-M01, RRID:AB_10903102
Product name
DEFA6 monoclonal antibody (M01), clone 2D2
Provider product page
Abnova Corporation - H00001671-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant DEFA6.
Antigen sequence
MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYE
ADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAF
TCHCRRSCYSTEYSYGTCTVMGINHRFCCL
Isotype
IgG
Antibody clone number
2D2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -