HPA019462

DEFA6 antibody from Sigma-Aldrich
DEF6, HD-6
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019462
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019462, RRID:AB_1847595
Product name
Anti-DEFA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019462
Antibody type
Polyclonal
Antigen
Defensin-6 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAE
DASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTV
MGINHRFC
Storage
-20C
Provider Type Product Number
- No reagents -