SAB1400077

DEFA6 antibody from Sigma-Aldrich
DEF6, HD-6
ELISA
Recommended by provider

Antibody data

Product number
SAB1400077
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400077, RRID:AB_1847596
Product name
Anti-DEFA6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB1400077
Antibody type
Polyclonal
Antigen
DEFA6 (NP_001917.1, a.a. 1-100) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYE
ADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAF
TCHCRRSCYSTEYSYGTCTVMGINHRFCCL (wit
hout GST)
Storage
-20C
Provider Type Product Number
- No reagents -