HPA023548

RUNDC3A antibody from Atlas Antibodies
RAP2IP, RPIP8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023548
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023548, RRID:AB_1856069
Product name
Anti-RUNDC3A
Provider product page
Atlas Antibodies - HPA023548
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKDLEAENRRLQLQLEEAAAQNQREKRELEGVILE
LQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLG
TLNGAEGASNSKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -