Antibody data

Product number
H00010900-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010900-M01, RRID:AB_1237857
Product name
RPIP8 monoclonal antibody (M01), clone 1A8
Provider product page
Abnova Corporation - H00010900-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RPIP8.
Antigen sequence
MEASFVQTTMALGLSSKKASSRNVAVERKNLITVC
RFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILS
HRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVP
NNCVSSIENMENISTARAKGRAWIRVALMEKRMSE
YITTALRDTRTTRRFYDSGAIMLRDEATILTGMLI
GLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQS
YDYLTDEEERYSAESSTSEDNSPEHPYLPLVTDED
SWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLK
DLEAENRRLQLQLEEAAAQNQREKRELEGVILELQ
EQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTL
NGAEGASNSKLYRRHSFMSTEPLSAEASLSSDSQR
LGEGTRDEEPWGPIGSSEPN
Isotype
IgG
Antibody clone number
1A8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -