HPA023548

RUNDC3A antibody from Sigma-Aldrich
RAP2IP, RPIP8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023548
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023548, RRID:AB_1856069
Product name
Anti-RUNDC3A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023548
Antibody type
Polyclonal
Antigen
RUN domain-containing protein 3A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKDLEAENRRLQLQLEEAAAQNQREKRELEGVILE
LQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLG
TLNGAEGASNSKL
Storage
-20C
Provider Type Product Number
- No reagents -