Antibody data

Product number
PAB20086
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20086, RRID:AB_10962480
Product name
ZNF205 polyclonal antibody
Provider product page
Abnova Corporation - PAB20086
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF205.
Antigen sequence
DHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHG
KGEASGSSRQAGDEKEWRGACTGAVEVGQRVQTSS
VAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSG
PAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEK
PNEE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -