AV38353

ZNF205 antibody from Sigma-Aldrich
Zfp13, ZNF210
No application information provided.

Antibody data

Product number
AV38353
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV38353, RRID:AB_1859121
Product name
Anti-ZNF205 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV38353
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF205 with an internal ID of P20540
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
EAVPSGDTQESLHIKMEPEEPHSEGASQEDGAQGA
WGWAPLSHGSKEKAL
Storage
-20C
Provider Type Product Number
- No reagents -