HPA001791

ZNF205 antibody from Sigma-Aldrich
Zfp13, ZNF210
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001791
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001791, RRID:AB_1080688
Product name
Anti-ZNF205 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001791
Antibody type
Polyclonal
Antigen
Zinc finger protein 205 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DHTQQNFYRDVLQKKNGLSLGFPFSRPFWAPQAHG
KGEASGSSRQAGDEKEWRGACTGAVEVGQRVQTSS
VAALGNVKPFRTRAGRVQWGVPQCAQEAACGRSSG
PAKDSGQPAEPDRTPDAAPPDPSPTEPQEYRVPEK
PNEE
Storage
-20C
Provider Type Product Number
- No reagents -