HPA003172

ZNF37A antibody from Atlas Antibodies
KOX21, ZNF37
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003172
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003172, RRID:AB_1080709
Product name
Anti-ZNF37A
Provider product page
Atlas Antibodies - HPA003172
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FITHQQTHPRENHYGNECGENIFEESILLEHQSVY
PFSQKLNLTPIQRTHSINNIIEYNECGTFFSEKLV
LHLQQRTHTGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -