HPA003172

ZNF37A antibody from Atlas Antibodies
KOX21, ZNF37
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003172
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003172, RRID:AB_889120
Product name
Anti-ZNF37A
Provider product page
Atlas Antibodies - HPA003172
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FITHQQTHPRENHYGNECGENIFEESILLEHQSVY
PFSQKLNLTPIQRTHSINNIIEYNECGTFFSEKLV
LHLQQRTHTGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -