Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1109582 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 37A (ZNF37A) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF37A antibody: synthetic peptide directed towards the middle region of human ZNF37A
- Description
- Purified using Protein A affinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
KPYECYACGKAFLRKSDLIKHQRIHTGEKPYECNE
CGKSFSEKSTLTKHL- Epitope
- Middle Region
- Vial size
- 0.1 mg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Duplicated KOX zinc finger gene clusters flank the centromere of human chromosome 10: evidence for a pericentric inversion during primate evolution.
Tunnacliffe A, Liu L, Moore JK, Leversha MA, Jackson MS, Papi L, Ferguson-Smith MA, Thiesen HJ, Ponder BA
Nucleic acids research 1993 Mar 25;21(6):1409-17
Nucleic acids research 1993 Mar 25;21(6):1409-17
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Human HepG2; WB Suggested Anti-ZNF37A Antibody Titration: 1.25ug/ml. ELISA Titer: 1:1562500. Positive Control: HepG2 cell lysate; ZNF37A antibody - middle region (AP42216PU-N) in Human HepG2 cells using Western Blot