HPA003172

ZNF37A antibody from Sigma-Aldrich
KOX21, ZNF37
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003172
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003172, RRID:AB_1080709
Product name
Anti-ZNF37A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003172
Antibody type
Polyclonal
Antigen
Zinc finger protein 37A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FITHQQTHPRENHYGNECGENIFEESILLEHQSVY
PFSQKLNLTPIQRTHSINNIIEYNECGTFFSEKLV
LHLQQRTHTGE
Storage
-20C
Provider Type Product Number
- No reagents -