Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00340811-M04 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00340811-M04, RRID:AB_10961969
- Product name
- AKR1CL1 monoclonal antibody (M04), clone 4G8
- Antibody type
- Monoclonal
- Antigen
- AKR1CL1 (NP_001007537.1, 1 a.a. ~ 129 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Reactivity
- Human
- Host
- Mouse
- Antigen sequence
MMTDLKQSHSVRLNDGPFMPVLGFGTYAPDHTPKS
QAAEATKVAIDVGFRHIDSAYLYQNEEEVGQAIWE
KIADGTVKREEIFYTIKLWATFFRAELVHPALERS
LKKLGPDYVDLFIIHVPFAMKGSS- Isotype
- IgG
- Vial size
- 100 µg
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of AKR1CL1 expression in transfected 293T cell line by AKR1CL1 monoclonal antibody (M04), clone 4G8.Lane 1: AKR1CL1 transfected lysate (Predicted MW: 14.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged AKR1CL1 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol