HPA003226

ZNF184 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003226
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003226, RRID:AB_2218705
Product name
Anti-ZNF184 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003226
Antibody type
Polyclonal
Antigen
Zinc finger protein 184 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VSKPDVISQLEQGTEPWIMEPSIPVGTCADWETRL
ENSVSAPEPDISEEELSPEVIVEKHKRDDSWSSNL
LESWEYEGSLERQQANQQTLPKEIKVTEKTIPSWE
KGPVNNEFGKSVNVSSNLVTQEPSPEETSTKRSIK
QN
Storage
-20C
Provider Type Product Number
- No reagents -