Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310731 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Carbonyl Reductase 1 (CBR1) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CBR1 antibody: synthetic peptide directed towards the C terminal of human CBR1
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAE
GPHGQ FVSEKRVEQW- Vial size
- 0.1 mg
Submitted references Effects of gamma-irradiation on the infectivity and chromosome aberration of Clonorchis sinensis.
Protein levels of genes encoded on chromosome 21 in fetal Down syndrome brain: Challenging the gene dosage effect hypothesis (Part IV).
Park GM, Yong TS
The Korean journal of parasitology 2003 Mar;41(1):41-5
The Korean journal of parasitology 2003 Mar;41(1):41-5
Protein levels of genes encoded on chromosome 21 in fetal Down syndrome brain: Challenging the gene dosage effect hypothesis (Part IV).
Cheon MS, Shim KS, Kim SH, Hara A, Lubec G
Amino acids 2003 Jul;25(1):41-7
Amino acids 2003 Jul;25(1):41-7
No comments: Submit comment
No validations: Submit validation data