HPA018433

CBR1 antibody from Atlas Antibodies
CBR, SDR21C1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA018433
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA018433, RRID:AB_1846109
Product name
Anti-CBR1
Provider product page
Atlas Antibodies - HPA018433
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRV
VNVSSIMSVRALKSCSPELQQKFRSETITEEELVG
LMNKFVE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -