HPA021307

DLG2 antibody from Sigma-Aldrich
chapsyn-110, PPP1R58, PSD-93, PSD93
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021307
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021307, RRID:AB_1846625
Product name
Anti-DLG2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021307
Antibody type
Polyclonal
Antigen
Disks large homolog 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGN
NGTLEYKTSLPPISPGRYSPIPKHMLVDDDYTRPP
EPVYSTVNKLCDKP
Storage
-20C
Provider Type Product Number
- No reagents -