HPA019770

FAM171A2 antibody from Atlas Antibodies
MGC34829
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019770
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019770, RRID:AB_1848383
Product name
Anti-FAM171A2
Provider product page
Atlas Antibodies - HPA019770
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RAFPAFLGTEASSSGNGSWLELMPLTAVSVHLLTG
NGTEVPLSGPIHLSLPVPSETRALTVGTSIPAWRF
DPKSGLWVRNGTGVIRKEGRQLYWTF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -