AV45005

TMEM231 antibody from Sigma-Aldrich
ALYE870, FLJ22167, JBTS20, MKS11, PRO1886
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV45005
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV45005, RRID:AB_1846725
Product name
Anti-FLJ22167 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV45005
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human FLJ22167 with an internal ID of P26082
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
LFNSGFWLKRSSYEEQPTVRFQHQVLLVALLGPES
DGFLAWSTFPAFNRL
Storage
-20C
Provider Type Product Number
- No reagents -