HPA003274

ZNF419 antibody from Sigma-Aldrich
ZAPHIR, ZNF419A
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003274
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003274, RRID:AB_1080714
Product name
Anti-ZNF419 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003274
Antibody type
Polyclonal
Antigen
Zinc finger protein 419A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLLDDAQRLLYRNVMLENFTLLASLGCWHGAEAEE
APEQIASVGLLSSNIQQHQKQHCGEKPLKRQEGRV
PV
Storage
-20C
Provider Type Product Number
- No reagents -