R32347
antibody from NSJ Bioreagents
Targeting: MCM8
C20orf154, dJ967N21.5, MGC119522, MGC119523, MGC12866, MGC4816, REC
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- R32347 - Provider product page
- Provider
- NSJ Bioreagents
- Product name
- MCM8 Antibody
- Antibody type
- Polyclonal
- Antigen
- Amino acids IQVADFENFIGSLNDQGYLLKKGPKVYQLQTM of human MCM8 were used as the immunogen for the MCM8 antibody.
- Description
- Antigen affinity
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Vial size
- 100 µg
- Concentration
- Lyophilized; resuspend with 200 ul for 0.5 mg/ml
- Storage
- After reconstitution, the MCM8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- NSJ Bioreagents (provider)
- Main image
- Experimental details
- Western blot testing of human 1) A549, 2) SW620, 3) HeLa, 4) PANC, and 5) HepG2 lysate with MCM8 antibody. Expected/observed molecular weight ~94/89 kDa (isoforms 1/2).