AV39206

ZNF777 antibody from Sigma-Aldrich
KIAA1285
No application information provided.

Antibody data

Product number
AV39206
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV39206, RRID:AB_1859450
Product name
Anti-ZNF777 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV39206
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF777 with an internal ID of P22976
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GGGRGPGEPFRAVNFLDNKMDETNQHGGRDLAAGH
SEGRCRAHLVGDRTL
Storage
-20C
Provider Type Product Number
- No reagents -