HPA003252

ZNF777 antibody from Sigma-Aldrich
KIAA1285
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003252
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003252, RRID:AB_1080755
Product name
Anti-ZNF777 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003252
Antibody type
Polyclonal
Antigen
Zinc finger protein 777 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LYKNVMRGNYESLVSMDYAISKPDLMSQMERGERP
TMQEQEDSEEGETPTDPSAAHDGIVIKIEVQTNDE
GSESLETPEPLMGQVEEHGFQDSELGDPCGEQPDL
DMQEPENTLEESTEGSSEFSELKQMLVQ
Storage
-20C
Provider Type Product Number
- No reagents -