HPA023424

GLT6D1 antibody from Sigma-Aldrich
GLTDC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023424
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023424, RRID:AB_1849729
Product name
Anti-GLT6D1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023424
Antibody type
Polyclonal
Antigen
Glycosyltransferase 6 domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQG
DFYYGNLMVGGTPHNILDFIKEYLNGVIHDIKNGL
NSTYE
Storage
-20C
Provider Type Product Number
- No reagents -