Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183639 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 177 (ZNF177) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF177 antibody: synthetic peptide directed towards the N terminal of human ZNF177
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
MAAGWLTTWSQNSVTFQEVAVDFSQEEWALLDPAQ
KNLYK DVMLENFRNL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Repetitive elements in the 5' untranslated region of a human zinc-finger gene modulate transcription and translation efficiency.
A transcribed gene in an intron of the human factor VIII gene.
Landry JR, Medstrand P, Mager DL
Genomics 2001 Aug;76(1-3):110-6
Genomics 2001 Aug;76(1-3):110-6
A transcribed gene in an intron of the human factor VIII gene.
Levinson B, Kenwrick S, Lakich D, Hammonds G Jr, Gitschier J
Genomics 1990 May;7(1):1-11
Genomics 1990 May;7(1):1-11
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting