HPA024205

KIF18B antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024205
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024205, RRID:AB_1852472
Product name
Anti-KIF18B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024205
Antibody type
Polyclonal
Antigen
Kinesin-like protein KIF18B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
STLQVVVRVRPPTPRELDSQRRPVVQVVDERVLVF
NPEEPDGGFPGLKWGGTHDGPKKKGKDLTFVFDRV
FGEAATQQDVFQHTTHSVLDSFLQGYN
Storage
-20C
Provider Type Product Number
- No reagents -