Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009252-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009252-M01, RRID:AB_1137429
- Product name
- RPS6KA5 monoclonal antibody (M01), clone 2B11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RPS6KA5.
- Antigen sequence
ILKSEPPYPQEMSALAKDLIQRLLMKDPKKRLGCG
PRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIR
DELDVSNFAEEFTEMDPTYSPAALPQSSEK- Isotype
- IgG
- Antibody clone number
- 2B11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RPS6KA5 expression in transfected 293T cell line by RPS6KA5 monoclonal antibody (M01), clone 2B11.Lane 1: RPS6KA5 transfected lysate(89.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RPS6KA5 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between NR4A1 and RPS6KA5. HeLa cells were stained with anti-NR4A1 rabbit purified polyclonal 1:1200 and anti-RPS6KA5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)
