Antibody data

Product number
H00007745-M11
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007745-M11, RRID:AB_1582060
Product name
ZNF192 monoclonal antibody (M11), clone 2E10
Provider product page
Abnova Corporation - H00007745-M11
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF192.
Antigen sequence
MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQ
ESSLHESNPLGQEVFRLRFRQLRYQETLGPREALI
QLRALCHQWLRPDLNTKEQI
Isotype
IgG
Antibody clone number
2E10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -