HPA019337

SRRM3 antibody from Sigma-Aldrich
FLJ37078
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019337
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019337, RRID:AB_1848909
Product name
Anti-AC005077.11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019337
Antibody type
Polyclonal
Antigen
SRRM2-like protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QGYSEEEIRQKVGTFRQMLMEKEGVLTREDRPGGH
IVAETPRLTEGAEPGLEYAPFDDDDGPVDCDCPAS
CYRGHRGYRTKH
Storage
-20C
Provider Type Product Number
- No reagents -