HPA019337

SRRM3 antibody from Atlas Antibodies
FLJ37078
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA019337
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA019337, RRID:AB_1848909
Product name
Anti-SRRM3
Provider product page
Atlas Antibodies - HPA019337
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QGYSEEEIRQKVGTFRQMLMEKEGVLTREDRPGGH
IVAETPRLTEGAEPGLEYAPFDDDDGPVDCDCPAS
CYRGHRGYRTKH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -