HPA003145

ZNF589 antibody from Sigma-Aldrich
SZF1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003145
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003145, RRID:AB_1080738
Product name
Anti-ZNF589 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003145
Antibody type
Polyclonal
Antigen
Zinc finger protein 589 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DVAVLFTEAEWKRLSLEQRNLYKEVMLENLRNLVS
LESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPG
FHAGNQLHPGNPCPEDQPQSQHPSDKNHRGAEAED
QRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSW
GGNR
Storage
-20C
Provider Type Product Number
- No reagents -