HPA024777

KLHL14 antibody from Sigma-Aldrich
KIAA1384
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024777
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024777, RRID:AB_1852576
Product name
Anti-KLHL14 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024777
Antibody type
Polyclonal
Antigen
Kelch-like protein 14 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IGGNHLKGFSHLDVMLVECYDPKGDQWNILQTPIL
EGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICY
CPEKGTWTELEGDVAEPLAGPACVTVILPSC
Storage
-20C
Provider Type Product Number
- No reagents -