H00007551-M08
antibody from Abnova Corporation
Targeting: ZNF3
A8-51, FLJ20216, HF.12, KOX25, PP838, Zfp113
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00007551-M08 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00007551-M08, RRID:AB_1137549
- Product name
- ZNF3 monoclonal antibody (M08), clone 1F7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ZNF3.
- Antigen sequence
METQADLVSQEPQALLDSALLSKVPAFSDKDSLGD
EMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEP
AQRDLYRDVMLENYGNVFSLDRETRTENDQEISED
TRSHG- Isotype
- IgG
- Antibody clone number
- 1F7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of ZNF3 expression in transfected 293T cell line by ZNF3 monoclonal antibody (M08), clone 1F7.Lane 1: ZNF3 transfected lysate(47.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged ZNF3 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to ZNF3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol