H00007551-M08

ZNF3 antibody from Abnova Corporation
A8-51, FLJ20216, HF.12, KOX25, PP838, Zfp113

Antibody data

Product number
H00007551-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00007551-M08, RRID:AB_1137549
Product name
ZNF3 monoclonal antibody (M08), clone 1F7
Provider product page
Abnova Corporation - H00007551-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ZNF3.
Antigen sequence
METQADLVSQEPQALLDSALLSKVPAFSDKDSLGD
EMLAAALLKAKSQELVTFEDVAVYFIRKEWKRLEP
AQRDLYRDVMLENYGNVFSLDRETRTENDQEISED
TRSHG
Isotype
IgG
Antibody clone number
1F7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -