HPA003719

ZNF3 antibody from Atlas Antibodies
A8-51, FLJ20216, HF.12, KOX25, PP838, Zfp113
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003719
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003719, RRID:AB_1080701
Product name
Anti-ZNF3
Provider product page
Atlas Antibodies - HPA003719
Antibody type
Polyclonal
Reactivity
Human, Mouse
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVT
FEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNV
FSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQ
GLKFKEAYEREVSLKRPLGNSPGERLNRK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -