HPA003719

ZNF3 antibody from Sigma-Aldrich
A8-51, FLJ20216, HF.12, KOX25, PP838, Zfp113
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003719
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003719, RRID:AB_1080701
Product name
Anti-ZNF3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003719
Antibody type
Polyclonal
Antigen
Zinc finger protein 38 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVT
FEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNV
FSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQ
GLKFKEAYEREVSLKRPLGNSPGERLNRK
Storage
-20C
Provider Type Product Number
- No reagents -