HPA021679

CHAF1B antibody from Atlas Antibodies
CAF-1, CAF1, CAF1A, CAF1P60, MPHOSPH7, MPP7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021679
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021679, RRID:AB_1846621
Product name
Anti-CHAF1B
Provider product page
Atlas Antibodies - HPA021679
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQN
TKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTP
PSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRP
RLDENKG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -