HPA021679

CHAF1B antibody from Sigma-Aldrich
CAF-1, CAF1, CAF1A, CAF1P60, MPHOSPH7, MPP7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021679
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021679, RRID:AB_1846621
Product name
Anti-CHAF1B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021679
Antibody type
Polyclonal
Antigen
Chromatin assembly factor 1 subunit B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PAPTVIRDPPSITPAVKSPLPGPSEEKTLQPSSQN
TKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTP
PSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRP
RLDENKG
Storage
-20C
Provider Type Product Number
- No reagents -