HPA019162

CTNNA2 antibody from MilliporeSigma / Merck KGaA
CAP-R, CT114
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019162
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA019162, RRID:AB_1846064
Product name
Anti-CTNNA2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA019162
Antibody type
Polyclonal
Antigen
Catenin alpha-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVK
LNYVAARRQQELKDPHCRDEMAAARGALKKNATML
YTASQAFLRHPDVAATRANRDYVFKQVQEAIAGIS
NAAQATSPTDEAKGHTGIGELAAALNEFDNKIILD
Storage
-20C
Provider Type Product Number
- No reagents -