HPA003204

ZNF268 antibody from Sigma-Aldrich
HZF3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003204
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003204, RRID:AB_1080663
Product name
Anti-ZNF10 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003204
Antibody type
Polyclonal
Antigen
Zinc finger protein 10 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RLEKGEEPWLVEREIHQETHPDSETAFEIKSSVSS
RSIFKDKQSCDIKMEGMARNDLWYLSLEEVWKCRD
QLDKYQENPERHLRQVAFTQKKVLTQERVSESGKY
GGNCLLPAQLV
Storage
-20C
Provider Type Product Number
- No reagents -