HPA003146

ZNF44 antibody from Sigma-Aldrich
KOX7, ZNF504, ZNF55, ZNF58
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003146
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003146, RRID:AB_1080723
Product name
Anti-ZNF44 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003146
Antibody type
Polyclonal
Antigen
Zinc finger protein 44 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HEEWALLGPSQKNLYRDVMRETIRNLNCIGMKWEN
QNIDDQHQNLRRNPRCDVVERFGKSKDGSQCGETL
SQIRNSIVNKNTPARVDACGSSVNGEVIMGHSSLN
CYIRVDTGHKHRECHEYAEK
Storage
-20C
Provider Type Product Number
- No reagents -