Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405285 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 540 (ZNF540) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ZNF540 antibody: synthetic peptide directed towards the middle region of human ZNF540
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
CGKAFRLNSHLTEHQRIHTGEKPYECKVCRKAFRQ
YSHLY QHQKTHNVI- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A novel human zinc finger protein ZNF540 interacts with MVP and inhibits transcriptional activities of the ERK signal pathway.
Xiang Z, Yuan W, Luo N, Wang Y, Tan K, Deng Y, Zhou X, Zhu C, Li Y, Liu M, Wu X, Li Y
Biochemical and biophysical research communications 2006 Aug 18;347(1):288-96
Biochemical and biophysical research communications 2006 Aug 18;347(1):288-96
No comments: Submit comment
No validations: Submit validation data