HPA003444

ZNF540 antibody from Sigma-Aldrich
DKFZp547B0714
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003444
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003444, RRID:AB_1080732
Product name
Anti-ZNF540 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003444
Antibody type
Polyclonal
Antigen
Zinc finger protein 540 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSSEKDIHEISLSKESIIEKSKTLRLKGSIFRNEW
QNKSEFEGQQGLKERSISQKKIVSKKMSTDRKRPS
FTLNQRIHNSEKSCDSHLVQHGKIDSDVKHDCKEC
GSTFNNVYQLTLHQKIHTGEKSCKCEKCGK
Storage
-20C
Provider Type Product Number
- No reagents -